PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005851m
Common NameCARUB_v10005851mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 181aa    MW: 20157.7 Da    PI: 5.7402
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005851mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26086.24.5e-275101198
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lr+ C ++C++ p+f +++ ++f+ vh++FGa nv k+ ++l  e+re+a+++l y Aear rdP++G++g+ l +++ l+ +++e+
  Carubv10005851m   5 PCAVCKILREPCGTNCIYKPHFTSDS-ARFQDVHQIFGAVNVAKIFNRLGSEDREIAANCLSYAAEARRRDPISGVYGMKLYYESILNDVEQEI 97 
                      7********************98876.99***********************************************************999999 PP

           DUF260  95 allk 98 
                       ++ 
  Carubv10005851m  98 RSAL 101
                      8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.444104IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-24599IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MASKPCAVCK ILREPCGTNC IYKPHFTSDS ARFQDVHQIF GAVNVAKIFN RLGSEDREIA  60
ANCLSYAAEA RRRDPISGVY GMKLYYESIL NDVEQEIRSA LNELETNLGP DQVPKFFDIP  120
IPDDFLNTTA SLDSYIEKIK NLTTVEKNNL LQFWKRENQK MGDGASTSAG PSTAFGEKHQ  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545910.0AC254591.1 Capsella rubella clone CAP08-M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284620.11e-135hypothetical protein CARUB_v10005851mg
SwissprotO496513e-65LBD32_ARATH; LOB domain-containing protein 32
TrEMBLR0H2291e-135R0H229_9BRAS; Uncharacterized protein
STRINGscaffold_702084.12e-76(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45251455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22700.12e-66LOB domain-containing protein 32